This is a code repository for the SIB - Swiss Institute of Bioinformatics CALIPHO group neXtProt project

See: https://www.nextprot.org/

The sequence viewer is a super easy javascript library to use in order to draw a protein sequence in a readable way.

Live demo: https://cdn.rawgit.com/calipho-sib/sequence-viewer/master/examples/index.html

Simple example: https://cdn.rawgit.com/calipho-sib/sequence-viewer/master/examples/simple.html

1. Include the library using bower or npm or simply by including the javascript sequence-viewer.js

//BOWER//
bower install sequence-viewer

//NODE//
npm install sequence-viewer

2. Specify a div in your html

<div id="sequence-viewer"></div>

3. Create an instance of Sequence in javascript and apply the render method

//For Node add before : var Sequence = require("sequence-viewer"); //


var seq = new Sequence('MALWMRLLPLLALLALWGPGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN');
// Render the sequence with or without rendering options
// (Check the interactive documentation)
seq.render('#sequence-viewer');

4. Et voila!

Note: if you choose the later approach with only the main javascript you should also include the dependencies, jquery,handlebars and bootstrap.min.css

Check out this interactive page for a better understanding of how to use the sequence viewer and its possibilities :

• https://cdn.rawgit.com/calipho-sib/sequence-viewer/master/examples/index.html

• Show chars per line
• Wrap lines
• Highlight
• Coverage
• Labels
• Toolbar (chars per line)
• Search
• Title
• sequenceMaxHeight
• Events
• Badge

https://search.nextprot.org/entry/NX_P01308/structures

If you have any problem or suggestion please open an issue here.

git clone https://github.com/calipho-sib/sequence-viewer.git

npm install (will install the development dependencies)

bower install (will install the browser dependencies)

...make your changes and modifications...

npm run dist (will create the min & bundle versions in dist/)

npm run build (will create the bundle js & css in build/ for node)

grunt bump (will push and add a new release)

npm publish (will publish in npm)

This software is licensed under the GNU GPL v2 license, quoted below.

Copyright (c) 2015, SIB Swiss Institute of Bioinformatics